ZNF625 antibody - N-terminal region (ARP39853_P050)

This is a rabbit polyclonal antibody against ZNF625. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
Gene Symbol: ZNF625
Protein Size: 306
Molecular Weight: 35kDa
Gene ID: 90589
Host: Rabbit
Application: WB
Clone: Polyclonal
Predicted Homology Based on Immunogen Sequence: Human
Peptide Sequence: MGERLLESKKDHQHGEILTQVPDDMLKKKTPRVKSCGEVSVGHASLNRHH